mcpbeat Sign in

Esm Protein Language Model Agent Skill

Protein language models (ESM3, ESM C) for sequence generation, structure prediction, inverse folding, and embeddings. Design novel proteins, extract ML features, or fold sequences. Local GPU or EvolutionaryScale Forge API. Use AlphaFold for traditional folding; RDKit for small molecules.

4k tokens
context cost
the whole folder, loaded on every use
1
files
instructions only
0
copies elsewhere
how many repositories repackaged it
294
stars on the repo
on the repository, not the skill itself

Install

one command, takes just this skill from the repository
npx skills add https://github.com/jaechang-hits/SciAgent-Skills --skill esm-protein-language-model

The instruction itself

27 sections, as written by the author

ESM — Protein Language Models

Overview

ESM (Evolutionary Scale Modeling) provides pretrained protein language models for generative protein design and representation learning. ESM3 is a multimodal generative model conditioned on sequence, structure, and function simultaneously. ESM C is an efficient embedding model optimized for extracting protein representations for downstream ML tasks.

When to Use

  • Generating novel protein sequences conditioned on desired structure or function
  • Extracting fixed-length embeddings from protein sequences for classification, clustering, or regression
  • Predicting 3D structure from amino acid sequence
  • Inverse folding: designing sequences that fold into a target structure
  • Annotating proteins with functional keywords (GO terms, EC numbers)
  • Comparing protein similarity via embedding distance instead of sequence alignment
  • Chain-of-thought protein design: iterative refinement of sequence/structure/function
  • For traditional physics-based structure prediction, use AlphaFold instead
  • For sequence alignment and homology search, use BLAST/HMMER via BioPython instead

Prerequisites

  • Python packages: esm (EvolutionaryScale package)
  • Hardware: GPU recommended for local inference (ESM3: 8GB+ VRAM; ESM C: 4GB+ VRAM). CPU works for small batches
  • Cloud alternative: EvolutionaryScale Forge API (requires API token from forge.evolutionaryscale.ai)
  • Model weights: Downloaded automatically on first use (~1-4 GB depending on model)
pip install esm
# For Forge cloud API
pip install esm[forge]

Quick Start

from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein

# Load ESM C model for embeddings
model = ESMC.from_pretrained("esmc_600m")

# Create protein from sequence
protein = ESMProtein(sequence="MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN")

# Get per-residue embeddings
output = model(protein)
embeddings = output.embeddings  # shape: (1, seq_len, embedding_dim)
print(f"Embedding shape: {embeddings.shape}")
# Embedding shape: (1, 101, 1152)

Core API

1. Protein Sequence Generation (ESM3)

Generate novel protein sequences conditioned on structure, function, or partial sequence.

from esm.models.esm3 import ESM3
from esm.sdk.api import ESM3InferenceClient, ESMProtein, GenerationConfig

# Load ESM3 locally
model = ESM3.from_pretrained("esm3_sm_open_v1")

# Generate from partial sequence (fill in masked positions)
prompt = ESMProtein(sequence="MKTAYIAK____ISFVK____RQLEERLG")  # ____ = positions to generate
config = GenerationConfig(track="sequence", num_steps=10, temperature=0.7)
generated = model.generate(prompt, config)
print(f"Generated sequence: {generated.sequence[:50]}...")
# Conditional generation: design sequence for a target structure
from esm.sdk.api import ESMProtein, GenerationConfig
from esm.utils.structure.protein_chain import ProteinChain

# Load target structure from PDB
chain = ProteinChain.from_pdb("target.pdb")
prompt = ESMProtein.from_protein_chain(chain)
prompt.sequence = None  # Clear sequence, keep structure

config = GenerationConfig(track="sequence", num_steps=16, temperature=0.5)
designed = model.generate(prompt, config)
print(f"Designed sequence ({len(designed.sequence)} residues): {designed.sequence[:50]}...")

2. Protein Embeddings (ESM C)

Extract fixed-length representations for downstream ML tasks.

from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch

model = ESMC.from_pretrained("esmc_600m")  # or "esmc_300m" for lighter model

sequences = [
    "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN",
    "MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS",
]

embeddings = []
for seq in sequences:
    protein = ESMProtein(sequence=seq)
    output = model(protein)
    # Mean-pool per-residue embeddings to get fixed-length vector
    mean_emb = output.embeddings.mean(dim=1)  # shape: (1, embedding_dim)
    embeddings.append(mean_emb)

emb_matrix = torch.cat(embeddings, dim=0)
print(f"Embedding matrix: {emb_matrix.shape}")  # (2, 1152)

# Compute pairwise similarity
similarity = torch.cosine_similarity(emb_matrix[0:1], emb_matrix[1:2])
print(f"Cosine similarity: {similarity.item():.4f}")

3. Structure Prediction

Predict 3D coordinates from amino acid sequence.

from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig

model = ESM3.from_pretrained("esm3_sm_open_v1")

protein = ESMProtein(sequence="MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN")

# Generate structure from sequence
config = GenerationConfig(track="structure", num_steps=16)
result = model.generate(protein, config)

# Save predicted structure
result.to_pdb("predicted.pdb")
print(f"Saved structure: {len(result.sequence)} residues → predicted.pdb")

4. Inverse Folding

Design amino acid sequences that fold into a target 3D structure.

from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig
from esm.utils.structure.protein_chain import ProteinChain

model = ESM3.from_pretrained("esm3_sm_open_v1")

# Load target structure
chain = ProteinChain.from_pdb("target_structure.pdb")
prompt = ESMProtein.from_protein_chain(chain)

# Clear sequence but keep structure coordinates
prompt.sequence = None

# Generate multiple designs
designs = []
for i in range(5):
    config = GenerationConfig(track="sequence", num_steps=16, temperature=0.7)
    designed = model.generate(prompt, config)
    designs.append(designed.sequence)
    print(f"Design {i+1}: {designed.sequence[:40]}...")

print(f"Generated {len(designs)} sequence designs for target structure")

5. Function Conditioning

Generate proteins with desired functional annotations (GO terms, enzyme activity).

from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig

model = ESM3.from_pretrained("esm3_sm_open_v1")

# Condition on functional keywords
protein = ESMProtein(
    sequence=None,  # generate de novo
    function_annotations=["ATP binding", "kinase activity", "protein phosphorylation"],
)

config = GenerationConfig(track="sequence", num_steps=32, temperature=0.7)
result = model.generate(protein, config)
print(f"Function-conditioned sequence: {result.sequence[:50]}...")
print(f"Length: {len(result.sequence)} residues")

6. Forge Cloud API

Use EvolutionaryScale's cloud inference for large models without local GPU.

from esm.sdk.forge import ESM3ForgeInferenceClient
from esm.sdk.api import ESMProtein, GenerationConfig

# Authenticate (requires FORGE_API_TOKEN env var or explicit token)
client = ESM3ForgeInferenceClient(model="esm3-open-2024-03", token="your_token_here")

protein = ESMProtein(sequence="MKTAYIAKQRQISFVKSHFSRQLEERLG")
config = GenerationConfig(track="structure", num_steps=16)
result = client.generate(protein, config)

result.to_pdb("forge_predicted.pdb")
print("Predicted structure via Forge API → forge_predicted.pdb")

Key Concepts

ESM3 vs ESM C: When to Use Which

| Feature | ESM3 | ESM C |

|---------|------|-------|

| Primary use | Generative protein design | Embedding extraction |

| Capabilities | Sequence generation, structure prediction, inverse folding, function conditioning | Per-residue and mean-pooled embeddings |

| Model sizes | esm3_sm_open_v1 (~1.4B params) | esmc_300m, esmc_600m |

| GPU requirement | 8GB+ VRAM | 4GB+ VRAM (esmc_300m: 2GB) |

| Use case | Design new proteins, predict structures | Downstream ML (classification, clustering, regression) |

| Cloud option | Forge API (larger models available) | Local only |

GenerationConfig Parameters

The GenerationConfig controls how ESM3 generates outputs:

  • track: Which modality to generate ("sequence", "structure", "function")
  • num_steps: Number of iterative refinement steps (higher = better quality, slower)
  • temperature: Sampling temperature (0.0 = greedy, 0.5-0.7 = diverse, 1.0 = maximum diversity)

ESMProtein Object

The central data container holding sequence, structure coordinates, and functional annotations:

  • .sequence — amino acid string (e.g., "MKTAY...")
  • .coordinates — 3D atom positions (Nx3 tensor)
  • .function_annotations — list of functional keywords
  • Use ESMProtein.from_protein_chain() to load from PDB structures
  • Use .to_pdb() to save predicted structures

Common Workflows

Workflow 1: Protein Embedding-Based Classification

Goal: Extract embeddings from protein sequences and train a downstream classifier.

from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
import numpy as np

model = ESMC.from_pretrained("esmc_600m")

# Embed a set of sequences
sequences = ["MKTAY...", "MKWVT...", "MSGLI..."]  # replace with actual sequences
labels = [0, 1, 0]  # binary labels

embeddings = []
for seq in sequences:
    protein = ESMProtein(sequence=seq)
    output = model(protein)
    mean_emb = output.embeddings.mean(dim=1).detach().cpu().numpy()
    embeddings.append(mean_emb.squeeze())

X = np.array(embeddings)
y = np.array(labels)
print(f"Feature matrix: {X.shape}")  # (n_samples, 1152)

# Train a simple classifier
from sklearn.linear_model import LogisticRegression
clf = LogisticRegression(max_iter=1000).fit(X, y)
print(f"Training accuracy: {clf.score(X, y):.2f}")

Workflow 2: Structure-Conditioned Protein Design

Goal: Design multiple novel sequences that fold into a target structure, then rank by predicted quality.

  • Load target structure from PDB using ProteinChain.from_pdb() (Core API module 4)
  • Create ESMProtein prompt with structure but no sequence
  • Generate 10+ sequence designs with temperature=0.7 for diversity (Core API module 1)
  • For each design, predict structure from designed sequence (Core API module 3)
  • Compare predicted structure to target structure (RMSD calculation) to rank designs
  • Select top designs for experimental validation

Key Parameters

| Parameter | Module/Function | Default | Range / Options | Effect |

|-----------|----------------|---------|-----------------|--------|

| num_steps | GenerationConfig | varies | 164 | Iterative refinement steps; more = higher quality, slower |

| temperature | GenerationConfig | 1.0 | 0.01.5 | Sampling diversity; 0.0=greedy, 0.7=balanced, 1.0+=creative |

| track | GenerationConfig | — | "sequence", "structure", "function" | Which modality to generate |

| model name | from_pretrained | — | "esm3_sm_open_v1", "esmc_300m", "esmc_600m" | Model size/capability tradeoff |

| token | ESM3ForgeInferenceClient | env var | API token string | Forge cloud authentication |

Best Practices

  • Use ESM C for embedding tasks, ESM3 for generation: ESM C is smaller, faster, and optimized for representation quality. Only use ESM3 when you need generative capabilities (sequence design, structure prediction, inverse folding).
  • Mean-pool per-residue embeddings for fixed-length representations: ESM C outputs per-residue embeddings (seq_len × dim). For downstream ML that requires fixed-length input, average across the sequence dimension: embeddings.mean(dim=1).
  • Use temperature 0.5–0.7 for protein design: Temperature 1.0 produces very diverse but potentially non-functional sequences. Temperature 0.5–0.7 balances diversity with quality. Use temperature 0.0 only for deterministic structure prediction.
  • Increase num_steps for higher-quality generation: More iterative refinement steps improve output quality at the cost of computation time. Use 8–16 steps for quick exploration, 32+ for final designs.
  • Batch sequences to maximize GPU utilization: Processing one sequence at a time underutilizes the GPU. When embedding many sequences, batch them (limited by VRAM).
  • Use Forge API for large-scale or large-model inference: The open-weight ESM3 is a smaller variant. For production-quality protein design, the Forge API provides access to larger models.

Common Recipes

Recipe: Pairwise Protein Similarity Matrix

from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
import numpy as np

model = ESMC.from_pretrained("esmc_300m")

sequences = {
    "Protein_A": "MKTAYIAKQRQISFVK...",
    "Protein_B": "MKWVTFISLLFLFSSAYS...",
    "Protein_C": "MSGLILQRAAVIAAGASSAG...",
}

# Extract embeddings
embs = {}
for name, seq in sequences.items():
    protein = ESMProtein(sequence=seq)
    output = model(protein)
    embs[name] = output.embeddings.mean(dim=1).detach().squeeze()

# Compute similarity matrix
names = list(embs.keys())
sim_matrix = np.zeros((len(names), len(names)))
for i, n1 in enumerate(names):
    for j, n2 in enumerate(names):
        sim_matrix[i, j] = torch.cosine_similarity(embs[n1].unsqueeze(0), embs[n2].unsqueeze(0)).item()

print("Similarity matrix:")
for i, name in enumerate(names):
    print(f"  {name}: {sim_matrix[i].round(3)}")

Recipe: Save/Load Embeddings for Reuse

from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
import numpy as np

model = ESMC.from_pretrained("esmc_600m")

# Generate and save
protein = ESMProtein(sequence="MKTAYIAKQRQISFVK...")
output = model(protein)
np.save("embedding.npy", output.embeddings.detach().cpu().numpy())
print("Saved embedding.npy")

# Load later (no GPU needed)
embedding = np.load("embedding.npy")
print(f"Loaded embedding: {embedding.shape}")

Troubleshooting

| Problem | Cause | Solution |

|---------|-------|----------|

| CUDA out of memory | Model too large for GPU | Use smaller model (esmc_300m), reduce batch size, or use Forge cloud API |

| RuntimeError: no CUDA device | No GPU available | Models work on CPU (slower). Set device="cpu" or use Forge API |

| Slow generation | Too many num_steps or CPU inference | Reduce num_steps (8 for drafts), use GPU, or use Forge API for large models |

| ImportError: esm | Package not installed | pip install esm (note: this is EvolutionaryScale's esm, not the older Facebook Research esm) |

| Low-quality generated sequences | Temperature too high or too few steps | Lower temperature to 0.5, increase num_steps to 32+ |

| Forge API authentication error | Invalid or missing API token | Set FORGE_API_TOKEN env var or pass token= explicitly; get token from forge.evolutionaryscale.ai |

| KeyError loading model weights | Wrong model name | Use exact names: "esm3_sm_open_v1", "esmc_300m", "esmc_600m" |

  • alphafold-database-access — retrieve predicted structures from AlphaFold DB; use ESM for de novo structure prediction
  • biopython — sequence I/O and alignment; preprocess sequences before ESM embedding
  • scikit-learn — downstream ML on ESM embeddings (classification, clustering, regression)
  • rdkit — cheminformatics for small-molecule drug design (complementary to protein design)

References

  • ESM GitHub — source code and model weights
  • EvolutionaryScale Forge — cloud inference API
  • Hayes et al. (2024) "Simulating 500 million years of evolution with a language model" — bioRxiv
  • Lin et al. (2023) "Evolutionary-scale prediction of atomic-level protein structure with a language model" — Science

Other skills for the same job

different authors, same section of the catalogue
Skill Creator
by anthropics
vendor ×10

Create new skills, modify and improve existing skills, and measure skill performance. Use when users want to create a skill from scratch, edit, or optimize an existing skill, run evals to test a skill, benchmark skill performance with variance analysis, or optimize a skill's description for better triggering accuracy.

56k tokens scripts
Geo Database
by christophacham
×4

Access NCBI GEO for gene expression/genomics data. Search/download microarray and RNA-seq datasets (GSE, GSM, GPL), retrieve SOFT/Matrix files, for transcriptomics and expression analysis.

12k tokens
Pymc Bayesian Modeling
by christophacham
×4

Bayesian modeling with PyMC. Build hierarchical models, MCMC (NUTS), variational inference, LOO/WAIC comparison, posterior checks, for probabilistic programming and inference.

24k tokens scripts
Pymoo
by christophacham
×4

Multi-objective optimization framework. NSGA-II, NSGA-III, MOEA/D, Pareto fronts, constraint handling, benchmarks (ZDT, DTLZ), for engineering design and optimization problems.

19k tokens scripts
Statsmodels
by ComeOnOliver
×4

Statistical modeling toolkit. OLS, GLM, logistic, ARIMA, time series, hypothesis tests, diagnostics, AIC/BIC, for rigorous statistical inference and econometric analysis.

41k tokens
Add Uint Support
by pytorch
vendor ×3

Add unsigned integer (uint) type support to PyTorch operators by updating AT_DISPATCH macros. Use when adding support for uint16, uint32, uint64 types to operators, kernels, or when user mentions enabling unsigned types, barebones unsigned types, or uint support.

2k tokens
At Dispatch V2
by pytorch
vendor ×3

Convert PyTorch AT_DISPATCH macros to AT_DISPATCH_V2 format in ATen C++ code. Use when porting AT_DISPATCH_ALL_TYPES_AND*, AT_DISPATCH_FLOATING_TYPES*, or other dispatch macros to the new v2 API. For ATen kernel files, CUDA kernels, and native operator implementations.

2k tokens
Docstring
by pytorch
vendor ×3

Write docstrings for PyTorch functions and methods following PyTorch conventions. Use when writing or updating docstrings in PyTorch code.

3k tokens

How to use it

Copy the folder

Take jaechang-hits/esm-protein-language-model from the repository into ~/.claude/skills for personal use, or into .claude/skills inside a project.

Check the name does not clash

The agent identifies a skill by the name field in its header. Two skills with the same name cannot sit side by side — one of them will be ignored.

Install what it needs

The instructions reference pip. Without those the skill loads but fails at the first command.