Protein language models (ESM3, ESM C) for sequence generation, structure prediction, inverse folding, and embeddings. Design novel proteins, extract ML features, or fold sequences. Local GPU or EvolutionaryScale Forge API. Use AlphaFold for traditional folding; RDKit for small molecules.
npx skills add https://github.com/jaechang-hits/SciAgent-Skills --skill esm-protein-language-model
ESM (Evolutionary Scale Modeling) provides pretrained protein language models for generative protein design and representation learning. ESM3 is a multimodal generative model conditioned on sequence, structure, and function simultaneously. ESM C is an efficient embedding model optimized for extracting protein representations for downstream ML tasks.
esm (EvolutionaryScale package)pip install esm
# For Forge cloud API
pip install esm[forge]
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
# Load ESM C model for embeddings
model = ESMC.from_pretrained("esmc_600m")
# Create protein from sequence
protein = ESMProtein(sequence="MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN")
# Get per-residue embeddings
output = model(protein)
embeddings = output.embeddings # shape: (1, seq_len, embedding_dim)
print(f"Embedding shape: {embeddings.shape}")
# Embedding shape: (1, 101, 1152)
Generate novel protein sequences conditioned on structure, function, or partial sequence.
from esm.models.esm3 import ESM3
from esm.sdk.api import ESM3InferenceClient, ESMProtein, GenerationConfig
# Load ESM3 locally
model = ESM3.from_pretrained("esm3_sm_open_v1")
# Generate from partial sequence (fill in masked positions)
prompt = ESMProtein(sequence="MKTAYIAK____ISFVK____RQLEERLG") # ____ = positions to generate
config = GenerationConfig(track="sequence", num_steps=10, temperature=0.7)
generated = model.generate(prompt, config)
print(f"Generated sequence: {generated.sequence[:50]}...")
# Conditional generation: design sequence for a target structure
from esm.sdk.api import ESMProtein, GenerationConfig
from esm.utils.structure.protein_chain import ProteinChain
# Load target structure from PDB
chain = ProteinChain.from_pdb("target.pdb")
prompt = ESMProtein.from_protein_chain(chain)
prompt.sequence = None # Clear sequence, keep structure
config = GenerationConfig(track="sequence", num_steps=16, temperature=0.5)
designed = model.generate(prompt, config)
print(f"Designed sequence ({len(designed.sequence)} residues): {designed.sequence[:50]}...")
Extract fixed-length representations for downstream ML tasks.
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
model = ESMC.from_pretrained("esmc_600m") # or "esmc_300m" for lighter model
sequences = [
"MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN",
"MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS",
]
embeddings = []
for seq in sequences:
protein = ESMProtein(sequence=seq)
output = model(protein)
# Mean-pool per-residue embeddings to get fixed-length vector
mean_emb = output.embeddings.mean(dim=1) # shape: (1, embedding_dim)
embeddings.append(mean_emb)
emb_matrix = torch.cat(embeddings, dim=0)
print(f"Embedding matrix: {emb_matrix.shape}") # (2, 1152)
# Compute pairwise similarity
similarity = torch.cosine_similarity(emb_matrix[0:1], emb_matrix[1:2])
print(f"Cosine similarity: {similarity.item():.4f}")
Predict 3D coordinates from amino acid sequence.
from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig
model = ESM3.from_pretrained("esm3_sm_open_v1")
protein = ESMProtein(sequence="MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN")
# Generate structure from sequence
config = GenerationConfig(track="structure", num_steps=16)
result = model.generate(protein, config)
# Save predicted structure
result.to_pdb("predicted.pdb")
print(f"Saved structure: {len(result.sequence)} residues → predicted.pdb")
Design amino acid sequences that fold into a target 3D structure.
from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig
from esm.utils.structure.protein_chain import ProteinChain
model = ESM3.from_pretrained("esm3_sm_open_v1")
# Load target structure
chain = ProteinChain.from_pdb("target_structure.pdb")
prompt = ESMProtein.from_protein_chain(chain)
# Clear sequence but keep structure coordinates
prompt.sequence = None
# Generate multiple designs
designs = []
for i in range(5):
config = GenerationConfig(track="sequence", num_steps=16, temperature=0.7)
designed = model.generate(prompt, config)
designs.append(designed.sequence)
print(f"Design {i+1}: {designed.sequence[:40]}...")
print(f"Generated {len(designs)} sequence designs for target structure")
Generate proteins with desired functional annotations (GO terms, enzyme activity).
from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig
model = ESM3.from_pretrained("esm3_sm_open_v1")
# Condition on functional keywords
protein = ESMProtein(
sequence=None, # generate de novo
function_annotations=["ATP binding", "kinase activity", "protein phosphorylation"],
)
config = GenerationConfig(track="sequence", num_steps=32, temperature=0.7)
result = model.generate(protein, config)
print(f"Function-conditioned sequence: {result.sequence[:50]}...")
print(f"Length: {len(result.sequence)} residues")
Use EvolutionaryScale's cloud inference for large models without local GPU.
from esm.sdk.forge import ESM3ForgeInferenceClient
from esm.sdk.api import ESMProtein, GenerationConfig
# Authenticate (requires FORGE_API_TOKEN env var or explicit token)
client = ESM3ForgeInferenceClient(model="esm3-open-2024-03", token="your_token_here")
protein = ESMProtein(sequence="MKTAYIAKQRQISFVKSHFSRQLEERLG")
config = GenerationConfig(track="structure", num_steps=16)
result = client.generate(protein, config)
result.to_pdb("forge_predicted.pdb")
print("Predicted structure via Forge API → forge_predicted.pdb")
| Feature | ESM3 | ESM C |
|---------|------|-------|
| Primary use | Generative protein design | Embedding extraction |
| Capabilities | Sequence generation, structure prediction, inverse folding, function conditioning | Per-residue and mean-pooled embeddings |
| Model sizes | esm3_sm_open_v1 (~1.4B params) | esmc_300m, esmc_600m |
| GPU requirement | 8GB+ VRAM | 4GB+ VRAM (esmc_300m: 2GB) |
| Use case | Design new proteins, predict structures | Downstream ML (classification, clustering, regression) |
| Cloud option | Forge API (larger models available) | Local only |
The GenerationConfig controls how ESM3 generates outputs:
track: Which modality to generate ("sequence", "structure", "function")num_steps: Number of iterative refinement steps (higher = better quality, slower)temperature: Sampling temperature (0.0 = greedy, 0.5-0.7 = diverse, 1.0 = maximum diversity)The central data container holding sequence, structure coordinates, and functional annotations:
.sequence — amino acid string (e.g., "MKTAY...").coordinates — 3D atom positions (Nx3 tensor).function_annotations — list of functional keywordsESMProtein.from_protein_chain() to load from PDB structures.to_pdb() to save predicted structuresGoal: Extract embeddings from protein sequences and train a downstream classifier.
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
import numpy as np
model = ESMC.from_pretrained("esmc_600m")
# Embed a set of sequences
sequences = ["MKTAY...", "MKWVT...", "MSGLI..."] # replace with actual sequences
labels = [0, 1, 0] # binary labels
embeddings = []
for seq in sequences:
protein = ESMProtein(sequence=seq)
output = model(protein)
mean_emb = output.embeddings.mean(dim=1).detach().cpu().numpy()
embeddings.append(mean_emb.squeeze())
X = np.array(embeddings)
y = np.array(labels)
print(f"Feature matrix: {X.shape}") # (n_samples, 1152)
# Train a simple classifier
from sklearn.linear_model import LogisticRegression
clf = LogisticRegression(max_iter=1000).fit(X, y)
print(f"Training accuracy: {clf.score(X, y):.2f}")
Goal: Design multiple novel sequences that fold into a target structure, then rank by predicted quality.
ProteinChain.from_pdb() (Core API module 4)temperature=0.7 for diversity (Core API module 1)| Parameter | Module/Function | Default | Range / Options | Effect |
|-----------|----------------|---------|-----------------|--------|
| num_steps | GenerationConfig | varies | 1–64 | Iterative refinement steps; more = higher quality, slower |
| temperature | GenerationConfig | 1.0 | 0.0–1.5 | Sampling diversity; 0.0=greedy, 0.7=balanced, 1.0+=creative |
| track | GenerationConfig | — | "sequence", "structure", "function" | Which modality to generate |
| model name | from_pretrained | — | "esm3_sm_open_v1", "esmc_300m", "esmc_600m" | Model size/capability tradeoff |
| token | ESM3ForgeInferenceClient | env var | API token string | Forge cloud authentication |
embeddings.mean(dim=1).from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
import numpy as np
model = ESMC.from_pretrained("esmc_300m")
sequences = {
"Protein_A": "MKTAYIAKQRQISFVK...",
"Protein_B": "MKWVTFISLLFLFSSAYS...",
"Protein_C": "MSGLILQRAAVIAAGASSAG...",
}
# Extract embeddings
embs = {}
for name, seq in sequences.items():
protein = ESMProtein(sequence=seq)
output = model(protein)
embs[name] = output.embeddings.mean(dim=1).detach().squeeze()
# Compute similarity matrix
names = list(embs.keys())
sim_matrix = np.zeros((len(names), len(names)))
for i, n1 in enumerate(names):
for j, n2 in enumerate(names):
sim_matrix[i, j] = torch.cosine_similarity(embs[n1].unsqueeze(0), embs[n2].unsqueeze(0)).item()
print("Similarity matrix:")
for i, name in enumerate(names):
print(f" {name}: {sim_matrix[i].round(3)}")
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
import numpy as np
model = ESMC.from_pretrained("esmc_600m")
# Generate and save
protein = ESMProtein(sequence="MKTAYIAKQRQISFVK...")
output = model(protein)
np.save("embedding.npy", output.embeddings.detach().cpu().numpy())
print("Saved embedding.npy")
# Load later (no GPU needed)
embedding = np.load("embedding.npy")
print(f"Loaded embedding: {embedding.shape}")
| Problem | Cause | Solution |
|---------|-------|----------|
| CUDA out of memory | Model too large for GPU | Use smaller model (esmc_300m), reduce batch size, or use Forge cloud API |
| RuntimeError: no CUDA device | No GPU available | Models work on CPU (slower). Set device="cpu" or use Forge API |
| Slow generation | Too many num_steps or CPU inference | Reduce num_steps (8 for drafts), use GPU, or use Forge API for large models |
| ImportError: esm | Package not installed | pip install esm (note: this is EvolutionaryScale's esm, not the older Facebook Research esm) |
| Low-quality generated sequences | Temperature too high or too few steps | Lower temperature to 0.5, increase num_steps to 32+ |
| Forge API authentication error | Invalid or missing API token | Set FORGE_API_TOKEN env var or pass token= explicitly; get token from forge.evolutionaryscale.ai |
| KeyError loading model weights | Wrong model name | Use exact names: "esm3_sm_open_v1", "esmc_300m", "esmc_600m" |
Create new skills, modify and improve existing skills, and measure skill performance. Use when users want to create a skill from scratch, edit, or optimize an existing skill, run evals to test a skill, benchmark skill performance with variance analysis, or optimize a skill's description for better triggering accuracy.
Access NCBI GEO for gene expression/genomics data. Search/download microarray and RNA-seq datasets (GSE, GSM, GPL), retrieve SOFT/Matrix files, for transcriptomics and expression analysis.
Bayesian modeling with PyMC. Build hierarchical models, MCMC (NUTS), variational inference, LOO/WAIC comparison, posterior checks, for probabilistic programming and inference.
Multi-objective optimization framework. NSGA-II, NSGA-III, MOEA/D, Pareto fronts, constraint handling, benchmarks (ZDT, DTLZ), for engineering design and optimization problems.
Statistical modeling toolkit. OLS, GLM, logistic, ARIMA, time series, hypothesis tests, diagnostics, AIC/BIC, for rigorous statistical inference and econometric analysis.
Add unsigned integer (uint) type support to PyTorch operators by updating AT_DISPATCH macros. Use when adding support for uint16, uint32, uint64 types to operators, kernels, or when user mentions enabling unsigned types, barebones unsigned types, or uint support.
Convert PyTorch AT_DISPATCH macros to AT_DISPATCH_V2 format in ATen C++ code. Use when porting AT_DISPATCH_ALL_TYPES_AND*, AT_DISPATCH_FLOATING_TYPES*, or other dispatch macros to the new v2 API. For ATen kernel files, CUDA kernels, and native operator implementations.
Write docstrings for PyTorch functions and methods following PyTorch conventions. Use when writing or updating docstrings in PyTorch code.
Take jaechang-hits/esm-protein-language-model from the repository into ~/.claude/skills for personal
use, or into .claude/skills inside a project.
The agent identifies a skill by the name field in its header. Two skills with the
same name cannot sit side by side — one of them will be ignored.
The instructions reference pip.
Without those the skill loads but fails at the first command.