mcpbeat

Biopython Molecular Biology

jaechang-hits/biopython-molecular-biology

Molecular biology toolkit: sequence manipulation, FASTA/GenBank/PDB I/O, NCBI Entrez, BLAST automation, pairwise/MSA alignment, Bio.PDB, phylogenetic trees. Use for batch processing, custom pipelines, format conversion, PubMed/GenBank queries. For quick gene lookups use gget; for multi-service REST APIs use bioservices.

This is a copy. The original lives at biotender-max/biopython-molecular-biology.

6k tokens
context cost
the whole folder, loaded on every use
1
files
instructions only
0
copies elsewhere
how many repositories repackaged it
294
stars on the repo
on the repository, not the skill itself

Install

one command, takes just this skill from the repository
npx skills add https://github.com/jaechang-hits/SciAgent-Skills --skill biopython-molecular-biology

The instruction itself

26 sections, as written by the author

Biopython: Computational Molecular Biology Toolkit

Overview

Biopython is the standard open-source Python library for computational molecular biology, providing modular APIs for sequence handling, biological file parsing, NCBI database access, BLAST searches, protein structure analysis, and phylogenetics. It supports Python 3 and requires NumPy.

When to Use

  • Parse and convert biological file formats (FASTA, GenBank, FASTQ, PDB, mmCIF, PHYLIP)
  • Fetch sequences or publications from NCBI databases (GenBank, PubMed, Protein) programmatically
  • Run and parse BLAST searches (remote NCBI or local BLAST+)
  • Perform pairwise or multiple sequence alignments with custom scoring
  • Analyze 3D protein structures — distances, angles, DSSP, superimposition
  • Build and visualize phylogenetic trees from sequence alignments
  • Calculate sequence statistics (GC content, molecular weight, melting temperature)
  • Batch-process thousands of sequences with custom filtering logic
  • Use pysam instead for reading SAM/BAM/CRAM alignment files and working with mapped reads; use scikit-bio instead for advanced ecological diversity metrics

Prerequisites

  • Python packages: biopython, numpy, matplotlib (for tree visualization)
  • Data requirements: Sequence files (FASTA, GenBank, FASTQ) or accession IDs for NCBI access
  • Environment: Python 3.8+; NCBI Entrez requires email registration
pip install biopython numpy matplotlib

Quick Start

from Bio import SeqIO
from Bio.Seq import Seq
from Bio.SeqUtils import gc_fraction

# Parse a FASTA file and compute basic statistics
records = list(SeqIO.parse("sequences.fasta", "fasta"))
print(f"Sequences loaded: {len(records)}")

seq = records[0].seq
print(f"ID: {records[0].id}")
print(f"Length: {len(seq)} bp")
print(f"GC content: {gc_fraction(seq)*100:.1f}%")
print(f"Reverse complement: {seq.reverse_complement()[:30]}...")
print(f"Protein translation: {seq.translate()[:10]}...")

Core API

Module 1: Sequence Objects (Bio.Seq)

Create and manipulate DNA, RNA, and protein sequences.

from Bio.Seq import Seq

# Create sequence and perform standard operations
dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG")
print(f"Length: {len(dna)} bp")
print(f"Complement: {dna.complement()}")
print(f"Reverse complement: {dna.reverse_complement()}")
print(f"Transcription: {dna.transcribe()}")
print(f"Translation: {dna.translate()}")
print(f"Translation (to stop): {dna.translate(to_stop=True)}")
# Length: 39 bp
# Translation: MAIVMGR*KGAR*
# Translation (to stop): MAIVMGR
from Bio.Seq import Seq

# Alternative genetic codes (e.g., mitochondrial)
mito_dna = Seq("ATGGCCATTGTAATGGGCCGCTGA")
std_protein = mito_dna.translate(table=1)      # Standard
mito_protein = mito_dna.translate(table=2)     # Vertebrate mitochondrial
print(f"Standard:      {std_protein}")
print(f"Mitochondrial: {mito_protein}")

# Find all start codons
coding_dna = Seq("ATGAAACCCATGGGGTTTAAATAG")
positions = [i for i in range(len(coding_dna) - 2) if coding_dna[i:i+3] == "ATG"]
print(f"ATG positions: {positions}")
# ATG positions: [0, 9]

Module 2: Sequence I/O (Bio.SeqIO)

Read, write, and convert biological file formats.

from Bio import SeqIO

# Parse FASTA file — returns SeqRecord iterator
records = list(SeqIO.parse("sequences.fasta", "fasta"))
print(f"Loaded {len(records)} sequences")
for rec in records[:3]:
    print(f"  {rec.id}: {len(rec.seq)} bp — {rec.description}")

# Parse GenBank — rich annotation access
for rec in SeqIO.parse("genome.gb", "genbank"):
    print(f"{rec.id}: {len(rec.features)} features, {len(rec.seq)} bp")
    for feat in rec.features[:5]:
        print(f"  {feat.type}: {feat.location}")

# Convert between formats
count = SeqIO.convert("input.gb", "genbank", "output.fasta", "fasta")
print(f"Converted {count} records: GenBank → FASTA")
from Bio import SeqIO
from Bio.SeqRecord import SeqRecord
from Bio.Seq import Seq

# Write sequences to file
records = [
    SeqRecord(Seq("ATCGATCG"), id="seq1", description="test sequence 1"),
    SeqRecord(Seq("GCTAGCTA"), id="seq2", description="test sequence 2"),
]
count = SeqIO.write(records, "output.fasta", "fasta")
print(f"Wrote {count} records to output.fasta")

# Filter sequences by length (streaming — memory efficient)
long_seqs = (rec for rec in SeqIO.parse("large_file.fasta", "fasta") if len(rec.seq) >= 200)
count = SeqIO.write(long_seqs, "filtered.fasta", "fasta")
print(f"Kept {count} sequences >= 200 bp")

# Index large FASTA for random access
idx = SeqIO.index("large_file.fasta", "fasta")
print(f"Indexed {len(idx)} sequences")
rec = idx["target_sequence_id"]
print(f"Retrieved: {rec.id}, {len(rec.seq)} bp")

Module 3: NCBI Database Access (Bio.Entrez)

Programmatic search and download from NCBI databases.

from Bio import Entrez, SeqIO

Entrez.email = "[email protected]"
# Entrez.api_key = "your_key"  # Optional: 10 req/s instead of 3 req/s

# Search PubMed
handle = Entrez.esearch(db="pubmed", term="CRISPR Cas9 2024", retmax=5)
results = Entrez.read(handle)
handle.close()
print(f"Found {results['Count']} articles, retrieved {len(results['IdList'])} IDs")
print(f"IDs: {results['IdList']}")

# Fetch GenBank record by accession
handle = Entrez.efetch(db="nucleotide", id="EU490707", rettype="gb", retmode="text")
record = SeqIO.read(handle, "genbank")
handle.close()
print(f"{record.id}: {record.description}")
print(f"Length: {len(record.seq)} bp, Features: {len(record.features)}")
from Bio import Entrez
import time

Entrez.email = "[email protected]"

# Batch download with rate limiting
handle = Entrez.esearch(db="protein", term="insulin[Protein Name] AND human[Organism]", retmax=20)
results = Entrez.read(handle)
handle.close()

# Fetch summaries in batch
ids = results["IdList"][:10]
handle = Entrez.esummary(db="protein", id=",".join(ids))
summaries = Entrez.read(handle)
handle.close()

for doc in summaries:
    print(f"  {doc['AccessionVersion']}: {doc['Title'][:60]}...")
print(f"\nFetched {len(summaries)} protein summaries")

Module 4: BLAST Operations (Bio.Blast)

Run and parse BLAST searches against NCBI or local databases.

from Bio.Blast import NCBIWWW, NCBIXML

# Remote BLAST search (nucleotide)
query_seq = "ATCGATCGATCGATCGATCGATCGATCGATCG"
result_handle = NCBIWWW.qblast("blastn", "nt", query_seq, hitlist_size=5)
blast_record = NCBIXML.read(result_handle)
result_handle.close()

print(f"Query: {blast_record.query[:50]}")
print(f"Database: {blast_record.database}")
print(f"Hits: {len(blast_record.alignments)}")

for aln in blast_record.alignments[:3]:
    hsp = aln.hsps[0]
    print(f"\n  {aln.title[:60]}...")
    print(f"  E-value: {hsp.expect:.2e}, Identity: {hsp.identities}/{hsp.align_length}")
    print(f"  Score: {hsp.score}, Bits: {hsp.bits:.1f}")
from Bio.Blast.Applications import NcbiblastpCommandline
from Bio.Blast import NCBIXML

# Local BLAST (requires BLAST+ installed)
blastp_cline = NcbiblastpCommandline(
    query="query.fasta",
    db="swissprot",
    evalue=1e-5,
    outfmt=5,  # XML output
    out="blast_results.xml",
    num_threads=4,
)
print(f"Command: {blastp_cline}")
# stdout, stderr = blastp_cline()  # Execute

# Parse local BLAST XML results
with open("blast_results.xml") as f:
    for record in NCBIXML.parse(f):
        print(f"Query: {record.query}")
        for aln in record.alignments[:3]:
            print(f"  Hit: {aln.hit_def[:50]}, E={aln.hsps[0].expect:.2e}")

Module 5: Pairwise Alignment (Bio.Align)

Global and local pairwise sequence alignment with customizable scoring.

from Bio import Align

# Global alignment
aligner = Align.PairwiseAligner()
aligner.mode = "global"
aligner.match_score = 2
aligner.mismatch_score = -1
aligner.open_gap_score = -5
aligner.extend_gap_score = -0.5

alignments = aligner.align("ACCGGTAACG", "ACGGTAAC")
print(f"Score: {alignments.score}")
print(f"Number of alignments: {len(alignments)}")
print(f"Best alignment:\n{alignments[0]}")
from Bio import Align
from Bio.Align import substitution_matrices

# Protein alignment with BLOSUM62
aligner = Align.PairwiseAligner()
aligner.mode = "local"
aligner.substitution_matrix = substitution_matrices.load("BLOSUM62")
aligner.open_gap_score = -10
aligner.extend_gap_score = -0.5

seq1 = "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"
seq2 = "MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST"
alignments = aligner.align(seq1, seq2)
print(f"Score: {alignments.score}")
print(f"Best alignment:\n{alignments[0]}")

Module 6: Protein Structure Analysis (Bio.PDB)

Parse PDB/mmCIF files and analyze 3D protein structures.

from Bio.PDB import PDBParser, PPBuilder

# Parse PDB structure
parser = PDBParser(QUIET=True)
structure = parser.get_structure("1CRN", "1crn.pdb")

# Navigate SMCRA hierarchy: Structure > Model > Chain > Residue > Atom
model = structure[0]
for chain in model:
    residues = list(chain.get_residues())
    print(f"Chain {chain.id}: {len(residues)} residues")

# Extract sequence from structure
ppb = PPBuilder()
for pp in ppb.build_peptides(structure):
    print(f"Peptide: {pp.get_sequence()[:50]}... ({len(pp.get_sequence())} aa)")

# Calculate CA-CA distance
chain_a = model["A"]
ca1 = chain_a[10]["CA"]
ca2 = chain_a[20]["CA"]
distance = ca1 - ca2
print(f"CA distance (res 10-20): {distance:.2f} Angstrom")
from Bio.PDB import PDBParser, Superimposer
import numpy as np

# Structure superimposition (RMSD calculation)
parser = PDBParser(QUIET=True)
struct1 = parser.get_structure("s1", "structure1.pdb")
struct2 = parser.get_structure("s2", "structure2.pdb")

# Get CA atoms for alignment
atoms1 = [res["CA"] for res in struct1[0]["A"].get_residues() if "CA" in res]
atoms2 = [res["CA"] for res in struct2[0]["A"].get_residues() if "CA" in res]

# Superimpose (requires same number of atoms)
n = min(len(atoms1), len(atoms2))
sup = Superimposer()
sup.set_atoms(atoms1[:n], atoms2[:n])
sup.apply(struct2.get_atoms())
print(f"RMSD: {sup.rms:.3f} Angstrom over {n} CA atoms")

Module 7: Phylogenetics (Bio.Phylo)

Build, manipulate, and visualize phylogenetic trees.

from Bio import Phylo, AlignIO
from Bio.Phylo.TreeConstruction import DistanceCalculator, DistanceTreeConstructor
import io

# Build tree from multiple sequence alignment
alignment = AlignIO.read("aligned_sequences.fasta", "fasta")
print(f"Alignment: {len(alignment)} sequences, {alignment.get_alignment_length()} positions")

# Calculate distance matrix and build NJ tree
calculator = DistanceCalculator("identity")
dm = calculator.get_distance(alignment)
print(f"Distance matrix:\n{dm}")

constructor = DistanceTreeConstructor()
nj_tree = constructor.nj(dm)
upgma_tree = constructor.upgma(dm)

# Visualize
Phylo.draw_ascii(nj_tree)

# Save tree
Phylo.write(nj_tree, "tree.nwk", "newick")
print("Saved tree.nwk")

Module 8: Sequence Utilities (Bio.SeqUtils)

Compute sequence statistics and physicochemical properties.

from Bio.Seq import Seq
from Bio.SeqUtils import gc_fraction, molecular_weight, MeltingTemp

dna = Seq("ATCGATCGATCGATCGATCG")
print(f"GC content: {gc_fraction(dna):.2%}")
print(f"Molecular weight: {molecular_weight(dna, seq_type='DNA'):.2f} Da")
print(f"Melting temp (basic): {MeltingTemp.Tm_Wallace(dna):.1f} C")
print(f"Melting temp (NN):    {MeltingTemp.Tm_NN(dna):.1f} C")

# Protein analysis
from Bio.SeqUtils.ProtParam import ProteinAnalysis
protein = ProteinAnalysis("MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTK")
print(f"\nProtein MW: {protein.molecular_weight():.2f} Da")
print(f"Isoelectric point: {protein.isoelectric_point():.2f}")
print(f"Aromaticity: {protein.aromaticity():.4f}")
print(f"Instability index: {protein.instability_index():.2f}")
print(f"GRAVY: {protein.gravy():.4f}")
aa_pct = protein.get_amino_acids_percent()
print(f"Top 3 amino acids: {sorted(aa_pct.items(), key=lambda x: -x[1])[:3]}")

Common Workflows

Workflow 1: Gene Sequence Retrieval and Analysis Pipeline

Goal: Fetch a gene from NCBI, analyze its properties, translate to protein, and compute statistics.

from Bio import Entrez, SeqIO
from Bio.Seq import Seq
from Bio.SeqUtils import gc_fraction
from Bio.SeqUtils.ProtParam import ProteinAnalysis

Entrez.email = "[email protected]"

# Step 1: Fetch gene from GenBank
handle = Entrez.efetch(db="nucleotide", id="NM_007294.4", rettype="gb", retmode="text")
record = SeqIO.read(handle, "genbank")
handle.close()
print(f"Gene: {record.description}")
print(f"Length: {len(record.seq)} bp")

# Step 2: Extract CDS
cds_features = [f for f in record.features if f.type == "CDS"]
if cds_features:
    cds = cds_features[0]
    cds_seq = cds.location.extract(record).seq
    print(f"CDS: {len(cds_seq)} bp, GC: {gc_fraction(cds_seq):.2%}")

    # Step 3: Translate
    protein_seq = cds_seq.translate(to_stop=True)
    print(f"Protein: {len(protein_seq)} aa")
    print(f"First 30 aa: {protein_seq[:30]}...")

    # Step 4: Protein properties
    analysis = ProteinAnalysis(str(protein_seq))
    print(f"MW: {analysis.molecular_weight():.0f} Da")
    print(f"pI: {analysis.isoelectric_point():.2f}")
    print(f"Instability: {analysis.instability_index():.1f}")
    print(f"GRAVY: {analysis.gravy():.3f}")

Workflow 2: Comparative Sequence Analysis with BLAST and Phylogeny

Goal: BLAST a protein sequence, fetch homologs, align, and build a phylogenetic tree.

from Bio.Blast import NCBIWWW, NCBIXML
from Bio import Entrez, SeqIO, AlignIO, Phylo
from Bio.Phylo.TreeConstruction import DistanceCalculator, DistanceTreeConstructor
from Bio.Align.Applications import MuscleCommandline
import time

Entrez.email = "[email protected]"

# Step 1: BLAST search
query = "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"
result_handle = NCBIWWW.qblast("blastp", "swissprot", query, hitlist_size=10)
blast_record = NCBIXML.read(result_handle)
print(f"BLAST hits: {len(blast_record.alignments)}")

# Step 2: Collect homolog accessions
accessions = []
for aln in blast_record.alignments[:8]:
    acc = aln.accession
    accessions.append(acc)
    print(f"  {acc}: E={aln.hsps[0].expect:.2e}, {aln.hit_def[:50]}...")

# Step 3: Fetch sequences and save for alignment
handle = Entrez.efetch(db="protein", id=",".join(accessions), rettype="fasta", retmode="text")
records = list(SeqIO.parse(handle, "fasta"))
handle.close()
SeqIO.write(records, "homologs.fasta", "fasta")
print(f"Saved {len(records)} homolog sequences")

# Step 4: Align (requires MUSCLE installed)
# muscle_cline = MuscleCommandline(input="homologs.fasta", out="aligned.fasta")
# muscle_cline()

# Step 5: Build phylogenetic tree from alignment
alignment = AlignIO.read("aligned.fasta", "fasta")
calculator = DistanceCalculator("blosum62")
dm = calculator.get_distance(alignment)
tree = DistanceTreeConstructor().nj(dm)
Phylo.draw_ascii(tree)
Phylo.write(tree, "homologs.nwk", "newick")
print("Saved phylogenetic tree to homologs.nwk")

Workflow 3: Batch Sequence Processing and Quality Filtering

Goal: Process a large FASTQ/FASTA dataset — filter by quality/length, compute statistics, and export.

from Bio import SeqIO
from Bio.SeqUtils import gc_fraction
import pandas as pd

# Step 1: Stream through large file and collect stats
stats = []
passed = []

for rec in SeqIO.parse("reads.fastq", "fastq"):
    seq_len = len(rec.seq)
    gc = gc_fraction(rec.seq)
    avg_qual = sum(rec.letter_annotations["phred_quality"]) / seq_len

    stats.append({"id": rec.id, "length": seq_len, "gc": gc, "avg_qual": avg_qual})

    # Filter: length >= 100 and avg quality >= 20
    if seq_len >= 100 and avg_qual >= 20:
        passed.append(rec)

# Step 2: Summary statistics
df = pd.DataFrame(stats)
print(f"Total reads: {len(df)}")
print(f"Passed QC:   {len(passed)} ({len(passed)/len(df)*100:.1f}%)")
print(f"\nLength:  mean={df['length'].mean():.0f}, median={df['length'].median():.0f}")
print(f"GC:      mean={df['gc'].mean():.2%}, std={df['gc'].std():.2%}")
print(f"Quality: mean={df['avg_qual'].mean():.1f}, min={df['avg_qual'].min():.1f}")

# Step 3: Export filtered reads
count = SeqIO.write(passed, "filtered_reads.fastq", "fastq")
print(f"\nExported {count} filtered reads to filtered_reads.fastq")

# Step 4: Save statistics
df.to_csv("read_statistics.csv", index=False)
print(f"Saved statistics to read_statistics.csv")

Key Parameters

| Parameter | Module | Default | Range / Options | Effect |

|-----------|--------|---------|-----------------|--------|

| Seq.translate(table=) | Bio.Seq | 1 (Standard) | 1-33 | NCBI genetic code table for translation |

| Seq.translate(to_stop=) | Bio.Seq | False | True, False | Stop at first stop codon vs translate entire sequence |

| SeqIO.parse(format=) | Bio.SeqIO | — | "fasta", "genbank", "fastq", "phylip" | File format for parsing |

| Entrez.email | Bio.Entrez | (required) | Valid email | NCBI requires email for tracking; set before any Entrez call |

| Entrez.api_key | Bio.Entrez | None | NCBI API key string | Increases rate limit from 3 to 10 requests/second |

| PairwiseAligner.mode | Bio.Align | "global" | "global", "local" | Needleman-Wunsch vs Smith-Waterman algorithm |

| PairwiseAligner.open_gap_score | Bio.Align | -1 | -20 to 0 | Penalty for opening a gap; more negative = fewer gaps |

| PairwiseAligner.substitution_matrix | Bio.Align | None | "BLOSUM62", "BLOSUM45", "PAM250" | Scoring matrix for protein alignment |

| PDBParser(QUIET=) | Bio.PDB | False | True, False | Suppress parser warnings for non-standard PDB files |

| DistanceCalculator(model=) | Bio.Phylo | "identity" | "identity", "blosum62" | Distance model for tree construction |

Common Recipes

Recipe: Restriction Enzyme Analysis

When to use: Find restriction sites in a DNA sequence for cloning design.

from Bio.Seq import Seq
from Bio.Restriction import EcoRI, BamHI, HindIII, RestrictionBatch, Analysis

seq = Seq("GAATTCAAAGGATCCTTTTAAGCTTGGGAATTC")

# Single enzyme
print(f"EcoRI cuts at: {EcoRI.search(seq)}")
print(f"BamHI cuts at: {BamHI.search(seq)}")

# Batch analysis
batch = RestrictionBatch([EcoRI, BamHI, HindIII])
analysis = Analysis(batch, seq)
result = analysis.full()
for enzyme, sites in result.items():
    if sites:
        print(f"{enzyme}: cuts at positions {sites}")

Recipe: Motif Discovery and Position Weight Matrix

When to use: Analyze transcription factor binding sites or consensus patterns.

from Bio import motifs
from Bio.Seq import Seq

# Create motif from observed binding sites
instances = [
    Seq("TACGAT"),
    Seq("TAGCAT"),
    Seq("TACGGT"),
    Seq("TAGCAT"),
    Seq("TACGAT"),
]
m = motifs.create(instances)
print(f"Consensus: {m.consensus}")
print(f"Degenerate: {m.degenerate_consensus}")
print(f"\nPosition Weight Matrix:")
print(m.counts)

# Score a new sequence against the motif
pwm = m.counts.normalize(pseudocounts=0.5)
pssm = pwm.log_odds()
test_seq = Seq("AATACGATCCC")
for pos, score in pssm.search(test_seq, threshold=0.0):
    print(f"  Position {pos}: score={score:.2f}")

Recipe: GenomeDiagram — Visualize Genomic Features

When to use: Create a circular or linear genome map from a GenBank file.

from Bio import SeqIO
from Bio.Graphics import GenomeDiagram
from reportlab.lib import colors
from reportlab.lib.units import cm

# Load annotated genome
record = SeqIO.read("plasmid.gb", "genbank")

# Create diagram
diagram = GenomeDiagram.Diagram(record.name)
track = diagram.new_track(1, name="Annotated Features", greytrack=True)
feature_set = track.new_set()

# Color features by type
color_map = {"CDS": colors.blue, "gene": colors.green, "promoter": colors.red}
for feature in record.features:
    if feature.type in color_map:
        feature_set.add_feature(feature, color=color_map[feature.type], label=True, label_size=8)

# Draw circular map
diagram.draw(format="circular", circular=True, pagesize=(20*cm, 20*cm), start=0, end=len(record))
diagram.write("genome_map.pdf", "PDF")
print(f"Saved genome_map.pdf ({len(record.features)} features)")

When to use: Programmatically search and download publication metadata.

from Bio import Entrez
import time

Entrez.email = "[email protected]"

# Search PubMed with complex query
query = "(CRISPR[Title]) AND (2024[Date - Publication]) AND (review[Publication Type])"
handle = Entrez.esearch(db="pubmed", term=query, retmax=100)
results = Entrez.read(handle)
handle.close()
print(f"Found {results['Count']} articles")

# Fetch abstracts in batches
ids = results["IdList"]
batch_size = 20
articles = []
for i in range(0, len(ids), batch_size):
    batch = ids[i:i+batch_size]
    handle = Entrez.efetch(db="pubmed", id=",".join(batch), rettype="xml")
    records = Entrez.read(handle)
    handle.close()
    for article in records["PubmedArticle"]:
        info = article["MedlineCitation"]["Article"]
        title = info.get("ArticleTitle", "N/A")
        abstract = info.get("Abstract", {}).get("AbstractText", ["N/A"])[0]
        articles.append({"title": title, "abstract": str(abstract)[:200]})
    time.sleep(0.4)  # Rate limiting

for a in articles[:5]:
    print(f"  {a['title'][:70]}...")
print(f"\nRetrieved {len(articles)} articles")

Troubleshooting

| Problem | Cause | Solution |

|---------|-------|----------|

| HTTPError 400 from Entrez | Invalid accession/ID or malformed query | Validate accessions; check query syntax with NCBI web interface first |

| HTTPError 429 (Too Many Requests) | Exceeding NCBI rate limit (3 req/s) | Set Entrez.api_key for 10 req/s; add time.sleep(0.4) between calls |

| ValueError: No records found in SeqIO.read() | Empty file or wrong format string | Use SeqIO.parse() to check if file has records; verify format matches actual content |

| Bio.PDB.PDBExceptions.PDBConstructionWarning | Non-standard atoms or occupancy issues | Use PDBParser(QUIET=True) or fix PDB with pdb-tools; check for alternate conformations |

| BLAST search times out | Large query or busy NCBI servers | Use local BLAST+ for large-scale searches; set NCBIWWW.qblast(hitlist_size=N) to limit results |

| Alignment has sequences of different lengths | Unaligned sequences passed to AlignIO | Align sequences first with MUSCLE/Clustal before loading as alignment |

| SeqIO.index() raises ValueError | Duplicate IDs in FASTA file | Deduplicate IDs with SeqIO.to_dict() or pre-process with awk |

| ImportError: No module named Bio | Biopython not installed in active environment | pip install biopython; verify with python -c "import Bio; print(Bio.__version__)" |

| translate() gives unexpected * | Stop codons in middle of sequence | Check reading frame; use Seq.translate(table=N) with correct genetic code |

| GenomeDiagram blank output | No features matched filter criteria | Check feature.type values in your GenBank file; print types to debug |

References

How to use it

Copy the folder

Take jaechang-hits/biopython-molecular-biology from the repository into ~/.claude/skills for personal use, or into .claude/skills inside a project.

Check the name does not clash

The agent identifies a skill by the name field in its header. Two skills with the same name cannot sit side by side — one of them will be ignored.

Install what it needs

The instructions reference pip. Without those the skill loads but fails at the first command.